![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily) alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143 |
![]() | Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) ![]() automatically mapped to Pfam PF00189 |
![]() | Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein) |
![]() | Protein Ribosomal protein S3 C-terminal domain [54823] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [160263] (24 PDB entries) Uniprot P0A7V3 106-206 |
![]() | Domain d2qb9c2: 2qb9 C:106-206 [150329] Other proteins in same PDB: d2qb9b1, d2qb9c1, d2qb9d1, d2qb9e1, d2qb9e2, d2qb9f1, d2qb9g1, d2qb9h1, d2qb9i1, d2qb9j1, d2qb9k1, d2qb9l1, d2qb9m1, d2qb9n1, d2qb9p1, d2qb9q1, d2qb9r1, d2qb9s1, d2qb9t1, d2qb9u1 automatically matched to 2AVY C:106-206 protein/RNA complex; complexed with lll, mg |
PDB Entry: 2qb9 (more details), 3.54 Å
SCOPe Domain Sequences for d2qb9c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qb9c2 d.53.1.1 (C:106-206) Ribosomal protein S3 C-terminal domain {Escherichia coli [TaxId: 562]} rkpeldaklvadsitsqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiarte wyregrvplhtlradidyntseahttygvigvkvwifkgei
Timeline for d2qb9c2: