Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins) |
Protein Ribosomal protein S3 N-terminal domain [54816] (4 species) |
Species Escherichia coli [TaxId:562] [160236] (24 PDB entries) Uniprot P0A7V3 1-105 |
Domain d2qb9c1: 2qb9 C:1-105 [150328] Other proteins in same PDB: d2qb9b1, d2qb9c2, d2qb9d1, d2qb9e1, d2qb9e2, d2qb9f1, d2qb9g1, d2qb9h1, d2qb9i1, d2qb9j1, d2qb9k1, d2qb9l1, d2qb9m1, d2qb9n1, d2qb9p1, d2qb9q1, d2qb9r1, d2qb9s1, d2qb9t1, d2qb9u1 automatically matched to 2AVY C:1-105 complexed with lll, mg |
PDB Entry: 2qb9 (more details), 3.54 Å
SCOP Domain Sequences for d2qb9c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qb9c1 d.52.3.1 (C:1-105) Ribosomal protein S3 N-terminal domain {Escherichia coli [TaxId: 562]} gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaev
Timeline for d2qb9c1: