Lineage for d2qb0c1 (2qb0 C:15-91)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770823Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 770824Superfamily a.60.1: SAM/Pointed domain [47769] (3 families) (S)
  5. 770825Family a.60.1.1: Pointed domain [47770] (6 proteins)
  6. 770835Protein Etv6 transcription factor pointed domain (Tel SAM) [74735] (2 species)
  7. 770836Species Escherichia coli [TaxId:562] [158525] (1 PDB entry)
  8. 770838Domain d2qb0c1: 2qb0 C:15-91 [150325]
    automatically matched to d1ji7c_
    complexed with mn

Details for d2qb0c1

PDB Entry: 2qb0 (more details), 2.56 Å

PDB Description: structure of the 2tel crystallization module fused to t4 lysozyme with an ala-gly-pro linker.
PDB Compounds: (C:) E80-TELSAM domain

SCOP Domain Sequences for d2qb0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qb0c1 a.60.1.1 (C:15-91) Etv6 transcription factor pointed domain (Tel SAM) {Escherichia coli [TaxId: 562]}
sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkalllltkedfryrs
phsgdelyellqhilkq

SCOP Domain Coordinates for d2qb0c1:

Click to download the PDB-style file with coordinates for d2qb0c1.
(The format of our PDB-style files is described here.)

Timeline for d2qb0c1: