SCOPe 2.06: Domain d2qaoh2: 2qao H:1-58

Lineage for d2qaoh2 (2qao H:1-58)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
   beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.100.1: L9 N-domain-like [55658] (3 families)

5. Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
   automatically mapped to Pfam PF01281

6. Protein Ribosomal protein L9 N-domain [55660] (3 species)

7. Species Escherichia coli [TaxId:562] [160581] (29 PDB entries)
   Uniprot P0A7R1 1-58

8. Domain d2qaoh2: 2qao H:1-58 [150300]
   Other proteins in same PDB: d2qao01, d2qao11, d2qao31, d2qao41, d2qaoc1, d2qaoc2, d2qaod1, d2qaoe1, d2qaof1, d2qaog1, d2qaog2, d2qaoh1, d2qaoi1, d2qaoi2, d2qaoj1, d2qaok1, d2qaol1, d2qaom1, d2qaon1, d2qaoo1, d2qaop1, d2qaoq1, d2qaor1, d2qaos1, d2qaot1, d2qaou1, d2qaov1, d2qaow1, d2qaox1, d2qaoy1, d2qaoz1
   protein/RNA complex; complexed with mg, nmy, zn
   protein/RNA complex; complexed with mg, nmy, zn

Details for d2qaoh2

PDB Entry: 2qao, 3.21 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with neomycin. This file contains the 50S subunit of the second 70S ribosome, with neomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (H:) 50S ribosomal protein L9

SCOPe Domain Sequences for d2qaoh2:

Sequence; same for both SEQRES and ATOM records:

>d2qaoh2 d.100.1.1 (H:1-58) Ribosomal protein L9 N-domain {Escherichia coli [TaxId: 562]}
mqvilldkvanlgslgdqvnvkagyarnflvpqgkavpatkknieffearraeleakl

Timeline for d2qaoh2:

• d2qaoh2 first appeared in SCOP 1.75
  
• d2qaoh2 appears in SCOPe 2.05
  
• d2qaoh2 appears in SCOPe 2.07
  
• d2qaoh2 appears in the current release, SCOPe 2.08