SCOPe 2.02: Domain d2qaog2: 2qao G:82-176

Lineage for d2qaog2 (2qao G:82-176)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Escherichia coli [TaxId:562] [160796] (27 PDB entries)
   Uniprot P02390 1-81! Uniprot P02390 82-176

8. Domain d2qaog2: 2qao G:82-176 [150298]
   Other proteins in same PDB: d2qao01, d2qao11, d2qao31, d2qao41, d2qaoc1, d2qaoc2, d2qaod1, d2qaoe1, d2qaof1, d2qaoh1, d2qaoh2, d2qaoi1, d2qaoi2, d2qaoj1, d2qaok1, d2qaol1, d2qaom1, d2qaon1, d2qaoo1, d2qaop1, d2qaoq1, d2qaor1, d2qaos1, d2qaot1, d2qaou1, d2qaov1, d2qaow1, d2qaox1, d2qaoy1, d2qaoz1
   automatically matched to 2AW4 G:82-176
   protein/RNA complex; complexed with mg, nmy, zn

Details for d2qaog2

PDB Entry: 2qao, 3.21 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with neomycin. This file contains the 50S subunit of the second 70S ribosome, with neomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (G:) 50S ribosomal protein L6

SCOPe Domain Sequences for d2qaog2:

Sequence; same for both SEQRES and ATOM records:

>d2qaog2 d.141.1.1 (G:82-176) Ribosomal protein L6 {Escherichia coli [TaxId: 562]}
ftkklqlvgvgyraavkgnvinlslgfshpvdhqlpagitaecptqteivlkgadkqvig
qvaadlrayrrpepykgkgvryadevvrtkeakkk

Timeline for d2qaog2:

• d2qaog2 first appeared in SCOP 1.75
  
• d2qaog2 appears in SCOPe 2.01
  
• d2qaog2 appears in SCOPe 2.03
  
• d2qaog2 appears in the current release, SCOPe 2.08