Lineage for d2qank1 (2qan K:12-128)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 837367Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 837368Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 837458Protein Ribosomal protein S11 [53141] (2 species)
  7. 837459Species Escherichia coli [TaxId:562] [159644] (24 PDB entries)
    Uniprot P0A7R9 12-128
  8. 837461Domain d2qank1: 2qan K:12-128 [150278]
    Other proteins in same PDB: d2qanb1, d2qanc1, d2qanc2, d2qand1, d2qane1, d2qane2, d2qanf1, d2qang1, d2qanh1, d2qani1, d2qanj1, d2qanl1, d2qanm1, d2qann1, d2qanp1, d2qanq1, d2qanr1, d2qans1, d2qant1, d2qanu1
    automatically matched to 2AVY K:12-128
    complexed with mg, nmy

Details for d2qank1

PDB Entry: 2qan (more details), 3.21 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with neomycin. This file contains the 30S subunit of the second 70S ribosome, with neomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (K:) 30S ribosomal protein S11

SCOP Domain Sequences for d2qank1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qank1 c.55.4.1 (K:12-128) Ribosomal protein S11 {Escherichia coli [TaxId: 562]}
rkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstpfaaqvaaercad
avkeygiknlevmvkgpgpgrestiralnaagfritnitdvtpiphngcrppkkrrv

SCOP Domain Coordinates for d2qank1:

Click to download the PDB-style file with coordinates for d2qank1.
(The format of our PDB-style files is described here.)

Timeline for d2qank1: