SCOPe 2.06: Domain d2qane2: 2qan E:9-77

Lineage for d2qane2 (2qan E:9-77)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families)

5. Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)
   automatically mapped to Pfam PF00333

6. Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species)
   lacks the N-terminal helix

7. Species Escherichia coli [TaxId:562] [160202] (24 PDB entries)
   Uniprot P0A7W1 9-77

8. Domain d2qane2: 2qan E:9-77 [150272]
   Other proteins in same PDB: d2qanb1, d2qanc1, d2qanc2, d2qand1, d2qane1, d2qanf1, d2qang1, d2qanh1, d2qani1, d2qanj1, d2qank1, d2qanl1, d2qanm1, d2qann1, d2qanp1, d2qanq1, d2qanr1, d2qans1, d2qant1, d2qanu1
   protein/RNA complex; complexed with mg, nmy
   protein/RNA complex; complexed with mg, nmy

Details for d2qane2

PDB Entry: 2qan, 3.21 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with neomycin. This file contains the 30S subunit of the second 70S ribosome, with neomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2qane2:

Sequence; same for both SEQRES and ATOM records:

>d2qane2 d.50.1.2 (E:9-77) Ribosomal S5 protein, N-terminal domain {Escherichia coli [TaxId: 562]}
elqekliavnrvsktvkggrifsftaltvvgdgngrvgfgygkarevpaaiqkamekarr
nminvalnn

Timeline for d2qane2:

• d2qane2 first appeared in SCOP 1.75
  
• d2qane2 appears in SCOPe 2.05
  
• d2qane2 appears in SCOPe 2.07
  
• d2qane2 appears in the current release, SCOPe 2.08