![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
![]() | Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) ![]() common motif in otherwise different folds |
![]() | Family d.66.1.2: Ribosomal protein S4 (bacteria) [55178] (1 protein) has a RRF/tRNA synthetase additional domain-like fold |
![]() | Protein Ribosomal protein S4 [55179] (3 species) also contains a Zn-binding N-terminal subdomain |
![]() | Species Escherichia coli [TaxId:562] [160439] (26 PDB entries) Uniprot P0A7V8 1-205 |
![]() | Domain d2qand1: 2qan D:1-205 [150270] Other proteins in same PDB: d2qanb1, d2qanc1, d2qanc2, d2qane1, d2qane2, d2qanf1, d2qang1, d2qanh1, d2qani1, d2qanj1, d2qank1, d2qanl1, d2qanm1, d2qann1, d2qanp1, d2qanq1, d2qanr1, d2qans1, d2qant1, d2qanu1 protein/RNA complex; complexed with mg, nmy protein/RNA complex; complexed with mg, nmy |
PDB Entry: 2qan (more details), 3.21 Å
SCOPe Domain Sequences for d2qand1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qand1 d.66.1.2 (D:1-205) Ribosomal protein S4 {Escherichia coli [TaxId: 562]} arylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkv rriygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshk aimvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegt fkrkpersdlsadinehlivelysk
Timeline for d2qand1: