Class b: All beta proteins [48724] (176 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein) automatically mapped to Pfam PF00297 |
Protein Ribosomal protein L3 [50462] (4 species) superfamily fold is elaborated with additional structures |
Species Escherichia coli [TaxId:562] [159159] (29 PDB entries) Uniprot P60438 1-209 |
Domain d2qamd1: 2qam D:1-209 [150241] Other proteins in same PDB: d2qam01, d2qam11, d2qam21, d2qam31, d2qam41, d2qamc1, d2qamc2, d2qame1, d2qamf1, d2qamg1, d2qamg2, d2qamh1, d2qamh2, d2qami1, d2qami2, d2qamj1, d2qamk1, d2qaml1, d2qamm1, d2qamn1, d2qamo1, d2qamp1, d2qamq1, d2qamr1, d2qams1, d2qamt1, d2qamu1, d2qamv1, d2qamw1, d2qamx1, d2qamy1, d2qamz1 protein/RNA complex; complexed with mg, nmy, zn protein/RNA complex; complexed with mg, nmy, zn |
PDB Entry: 2qam (more details), 3.21 Å
SCOPe Domain Sequences for d2qamd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qamd1 b.43.3.2 (D:1-209) Ribosomal protein L3 {Escherichia coli [TaxId: 562]} miglvgkkvgmtriftedgvsipvtvieveanrvtqvkdlandgyraiqvttgakkanrv tkpeaghfakagveagrglwefrlaegeeftvgqsisvelfadvkkvdvtgtskgkgfag tvkrwnfrtqdathgnslshrvpgsigqnqtpgkvfkgkkmagqmgnervtvqsldvvrv daernlllvkgavpgatgsdlivkpavka
Timeline for d2qamd1:
View in 3D Domains from other chains: (mouse over for more information) d2qam01, d2qam11, d2qam21, d2qam31, d2qam41, d2qamc1, d2qamc2, d2qame1, d2qamf1, d2qamg1, d2qamg2, d2qamh1, d2qamh2, d2qami1, d2qami2, d2qamj1, d2qamk1, d2qaml1, d2qamm1, d2qamn1, d2qamo1, d2qamp1, d2qamq1, d2qamr1, d2qams1, d2qamt1, d2qamu1, d2qamv1, d2qamw1, d2qamx1, d2qamy1, d2qamz1 |