Lineage for d2qalu1 (2qal U:3-53)

  1. Root: SCOPe 2.03
  2. 1470528Class j: Peptides [58231] (120 folds)
  3. 1472388Fold j.122: Ribosomal protein S21p [161307] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 1472389Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family) (S)
  5. 1472390Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein)
    Pfam PF01165
  6. 1472391Protein Ribosomal protein S21, RpsU [161310] (1 species)
  7. 1472392Species Escherichia coli [TaxId:562] [161311] (24 PDB entries)
    Uniprot P68679 4-54
  8. 1472394Domain d2qalu1: 2qal U:3-53 [150233]
    Other proteins in same PDB: d2qalb1, d2qalc1, d2qalc2, d2qald1, d2qale1, d2qale2, d2qalf1, d2qalg1, d2qalh1, d2qali1, d2qalj1, d2qalk1, d2qall1, d2qalm1, d2qaln1, d2qalp1, d2qalq1, d2qalr1, d2qals1, d2qalt1
    automatically matched to 2AVY U:3-53
    protein/RNA complex; complexed with mg, nmy

Details for d2qalu1

PDB Entry: 2qal (more details), 3.21 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with neomycin. This file contains the 30S subunit of the first 70S ribosome, with neomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (U:) 30S ribosomal protein S21

SCOPe Domain Sequences for d2qalu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qalu1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]}
ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk

SCOPe Domain Coordinates for d2qalu1:

Click to download the PDB-style file with coordinates for d2qalu1.
(The format of our PDB-style files is described here.)

Timeline for d2qalu1: