Lineage for d2qalt1 (2qal T:2-86)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
    automatically mapped to Pfam PF01649
  5. Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
  6. Protein Ribosomal protein S20 [46994] (2 species)
  7. Species Escherichia coli [TaxId:562] [158365] (26 PDB entries)
    Uniprot P0A7U7 2-86
  8. Domain d2qalt1: 2qal T:2-86 [150232]
    Other proteins in same PDB: d2qalb1, d2qalc1, d2qalc2, d2qald1, d2qale1, d2qale2, d2qalf1, d2qalg1, d2qalh1, d2qali1, d2qalj1, d2qalk1, d2qall1, d2qalm1, d2qaln1, d2qalp1, d2qalq1, d2qalr1, d2qals1, d2qalu1
    protein/RNA complex; complexed with mg, nmy
    protein/RNA complex; complexed with mg, nmy

Details for d2qalt1

PDB Entry: 2qal (more details), 3.21 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with neomycin. This file contains the 30S subunit of the first 70S ribosome, with neomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (T:) 30S ribosomal protein S20

SCOPe Domain Sequences for d2qalt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qalt1 a.7.6.1 (T:2-86) Ribosomal protein S20 {Escherichia coli [TaxId: 562]}
niksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrqa
akglihknkaarhkanltaqinkla

SCOPe Domain Coordinates for d2qalt1 are not available.

Timeline for d2qalt1:

Domains from other chains:
(mouse over for more information)
d2qalb1, d2qalc1, d2qalc2, d2qald1, d2qale1, d2qale2, d2qalf1, d2qalg1, d2qalh1, d2qali1, d2qalj1, d2qalk1, d2qall1, d2qalm1, d2qaln1, d2qalp1, d2qalq1, d2qalr1, d2qals1, d2qalu1