Lineage for d2qals1 (2qal S:2-80)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857955Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 857956Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
  5. 857957Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 857958Protein Ribosomal protein S19 [54572] (2 species)
  7. 857959Species Escherichia coli [TaxId:562] [160144] (26 PDB entries)
    Uniprot P0A7U3 2-80
  8. 857962Domain d2qals1: 2qal S:2-80 [150231]
    Other proteins in same PDB: d2qalb1, d2qalc1, d2qalc2, d2qald1, d2qale1, d2qale2, d2qalf1, d2qalg1, d2qalh1, d2qali1, d2qalj1, d2qalk1, d2qall1, d2qalm1, d2qaln1, d2qalp1, d2qalq1, d2qalr1, d2qalt1, d2qalu1
    automatically matched to 2AVY S:2-80
    complexed with mg, nmy

Details for d2qals1

PDB Entry: 2qal (more details), 3.21 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with neomycin. This file contains the 30S subunit of the first 70S ribosome, with neomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (S:) 30S ribosomal protein S19

SCOP Domain Sequences for d2qals1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qals1 d.28.1.1 (S:2-80) Ribosomal protein S19 {Escherichia coli [TaxId: 562]}
rslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfv
tdemvghklgefaptrtyr

SCOP Domain Coordinates for d2qals1:

Click to download the PDB-style file with coordinates for d2qals1.
(The format of our PDB-style files is described here.)

Timeline for d2qals1: