Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
Protein Ribosomal protein S17 [50304] (3 species) |
Species Escherichia coli [TaxId:562] [159088] (26 PDB entries) Uniprot P02373 3-82 |
Domain d2qalq1: 2qal Q:3-82 [150229] Other proteins in same PDB: d2qalb1, d2qalc1, d2qalc2, d2qald1, d2qale1, d2qale2, d2qalf1, d2qalg1, d2qalh1, d2qali1, d2qalj1, d2qalk1, d2qall1, d2qalm1, d2qaln1, d2qalp1, d2qalr1, d2qals1, d2qalt1, d2qalu1 automatically matched to 2AVY Q:3-82 protein/RNA complex; complexed with mg, nmy |
PDB Entry: 2qal (more details), 3.21 Å
SCOPe Domain Sequences for d2qalq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qalq1 b.40.4.5 (Q:3-82) Ribosomal protein S17 {Escherichia coli [TaxId: 562]} kirtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveire crplsktkswtlvrvvekav
Timeline for d2qalq1: