![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
![]() | Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein) |
![]() | Protein Ribosomal protein S14 [57753] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [161162] (24 PDB entries) Uniprot P02370 1-100 |
![]() | Domain d2qaln1: 2qal N:1-100 [150227] Other proteins in same PDB: d2qalb1, d2qalc1, d2qalc2, d2qald1, d2qale1, d2qale2, d2qalf1, d2qalg1, d2qalh1, d2qali1, d2qalj1, d2qalk1, d2qall1, d2qalm1, d2qalp1, d2qalq1, d2qalr1, d2qals1, d2qalt1, d2qalu1 protein/RNA complex; complexed with mg, nmy protein/RNA complex; complexed with mg, nmy has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2qal (more details), 3.21 Å
SCOPe Domain Sequences for d2qaln1:
Sequence, based on SEQRES records: (download)
>d2qaln1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]} akqsmkarevkrvaladkyfakraelkaiisdvnasdedrwnavlklqtlprdsspsrqr nrcrqtgrphgflrkfglsrikvreaamrgeipglkkasw
>d2qaln1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]} akqsmkarevkrvaladkyfakraelkaiisdvnarwnavlklqtlprdsspsrqrnrcr qtgrphgflrkfglsrikvreaamrgeipglkkasw
Timeline for d2qaln1: