![]() | Class i: Low resolution protein structures [58117] (26 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
![]() | Protein 70S ribosome functional complex [58121] (9 species) |
![]() | Species Escherichia coli [TaxId:562] [58123] (72 PDB entries) |
![]() | Domain d2qalh1: 2qal H:2-128 [150221] Other proteins in same PDB: d2qalb1, d2qalc1, d2qalc2, d2qald1, d2qale1, d2qale2, d2qalf1, d2qalg1, d2qali1, d2qalj1, d2qalk1, d2qall1, d2qalm1, d2qaln1, d2qalp1, d2qalq1, d2qalr1, d2qals1, d2qalt1, d2qalu1 automatically matched to d1p6gh_ complexed with mg, nmy |
PDB Entry: 2qal (more details), 3.21 Å
SCOP Domain Sequences for d2qalh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qalh1 i.1.1.1 (H:2-128) 70S ribosome functional complex {Escherichia coli [TaxId: 562]} mqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpelelt lkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglg geiicyv
Timeline for d2qalh1: