Lineage for d1a6n__ (1a6n -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (17 proteins) Protein Myoglobin [46469] (9 species) Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (131 PDB entries) 
Domain d1a6n__: 1a6n - [15022]
Details for d1a6n__
PDB Entry: 1a6n (more details), 1.15 Å
PDB Description: deoxy-myoglobin, atomic resolution
SCOP Domain Sequences for d1a6n__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a6n__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgy
SCOP Domain Coordinates for d1a6n__:
Click to download the PDB-style file with coordinates for d1a6n__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a6n__:
- d1a6n__ first appeared (with stable ids) in SCOP 1.55
- d1a6n__ appears in SCOP 1.59
- d1a6n__ appears in the current release, SCOPe 2.08, called d1a6na_
View in 3D