SCOPe 2.07: Domain d2qalc2: 2qal C:106-206

Lineage for d2qalc2 (2qal C:106-206)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
   alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143

4. Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family)
   automatically mapped to Pfam PF00189

5. Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)

6. Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)

7. Species Escherichia coli [TaxId:562] [160263] (24 PDB entries)
   Uniprot P0A7V3 106-206

8. Domain d2qalc2: 2qal C:106-206 [150215]
   Other proteins in same PDB: d2qalb1, d2qalc1, d2qald1, d2qale1, d2qale2, d2qalf1, d2qalg1, d2qalh1, d2qali1, d2qalj1, d2qalk1, d2qall1, d2qalm1, d2qaln1, d2qalp1, d2qalq1, d2qalr1, d2qals1, d2qalt1, d2qalu1
   protein/RNA complex; complexed with mg, nmy
   protein/RNA complex; complexed with mg, nmy

Details for d2qalc2

PDB Entry: 2qal, 3.21 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with neomycin. This file contains the 30S subunit of the first 70S ribosome, with neomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2qalc2:

Sequence; same for both SEQRES and ATOM records:

>d2qalc2 d.53.1.1 (C:106-206) Ribosomal protein S3 C-terminal domain {Escherichia coli [TaxId: 562]}
rkpeldaklvadsitsqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiarte
wyregrvplhtlradidyntseahttygvigvkvwifkgei

Timeline for d2qalc2:

• d2qalc2 first appeared in SCOP 1.75
  
• d2qalc2 appears in SCOPe 2.06
  
• d2qalc2 appears in the current release, SCOPe 2.08