Lineage for d2qalc2 (2qal C:106-206)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203196Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 1203197Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
  5. 1203198Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 1203199Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)
  7. 1203200Species Escherichia coli [TaxId:562] [160263] (24 PDB entries)
    Uniprot P0A7V3 106-206
  8. 1203202Domain d2qalc2: 2qal C:106-206 [150215]
    Other proteins in same PDB: d2qalb1, d2qalc1, d2qald1, d2qale1, d2qale2, d2qalf1, d2qalg1, d2qalh1, d2qali1, d2qalj1, d2qalk1, d2qall1, d2qalm1, d2qaln1, d2qalp1, d2qalq1, d2qalr1, d2qals1, d2qalt1, d2qalu1
    automatically matched to 2AVY C:106-206
    protein/RNA complex; complexed with mg, nmy

Details for d2qalc2

PDB Entry: 2qal (more details), 3.21 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with neomycin. This file contains the 30S subunit of the first 70S ribosome, with neomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2qalc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qalc2 d.53.1.1 (C:106-206) Ribosomal protein S3 C-terminal domain {Escherichia coli [TaxId: 562]}
rkpeldaklvadsitsqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiarte
wyregrvplhtlradidyntseahttygvigvkvwifkgei

SCOPe Domain Coordinates for d2qalc2:

Click to download the PDB-style file with coordinates for d2qalc2.
(The format of our PDB-style files is described here.)

Timeline for d2qalc2: