Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) fold elaborated with additional structures |
Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein) |
Protein Ribosomal protein S2 [52315] (3 species) |
Species Escherichia coli [TaxId:562] [159491] (26 PDB entries) Uniprot P0A7V0 8-225 |
Domain d2qalb1: 2qal B:8-225 [150213] Other proteins in same PDB: d2qalc1, d2qalc2, d2qald1, d2qale1, d2qale2, d2qalf1, d2qalg1, d2qalh1, d2qali1, d2qalj1, d2qalk1, d2qall1, d2qalm1, d2qaln1, d2qalp1, d2qalq1, d2qalr1, d2qals1, d2qalt1, d2qalu1 automatically matched to 2AVY B:8-225 protein/RNA complex; complexed with mg, nmy |
PDB Entry: 2qal (more details), 3.21 Å
SCOPe Domain Sequences for d2qalb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qalb1 c.23.15.1 (B:8-225) Ribosomal protein S2 {Escherichia coli [TaxId: 562]} mlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnkiasrkgkil fvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletqsqdgtfdk ltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlgipvfaivd tnsdpdgvdfvipgnddairavtlylgavaatvregrs
Timeline for d2qalb1: