SCOPe 2.05: Domain d2qadd2: 2qad D:114-214

Lineage for d2qadd2 (2qad D:114-214)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d2qadd2: 2qad D:114-214 [150206]
   Other proteins in same PDB: d2qadb1, d2qadb2, d2qadd1, d2qadf1, d2qadf2, d2qadh1
   automatically matched to d1ngzb2
   complexed with edo, mla, nag

Details for d2qadd2

PDB Entry: 2qad, 3.3 Å

PDB Description: structure of tyrosine-sulfated 412d antibody complexed with hiv-1 yu2 gp120 and cd4

PDB Compounds: (D:) anti-HIV-1 antibody 412d heavy chain

SCOPe Domain Sequences for d2qadd2:

Sequence; same for both SEQRES and ATOM records:

>d2qadd2 b.1.1.2 (D:114-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Timeline for d2qadd2:

• d2qadd2 first appeared in SCOP 1.75
  
• d2qadd2 appears in SCOPe 2.04
  
• d2qadd2 appears in SCOPe 2.06
  
• d2qadd2 appears in the current release, SCOPe 2.08