Lineage for d2qadb2 (2qad B:98-178)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1518579Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 1518589Protein CD4 C2-set domains [49149] (2 species)
  7. 1518590Species Human (Homo sapiens) [TaxId:9606] [49150] (31 PDB entries)
  8. 1518615Domain d2qadb2: 2qad B:98-178 [150204]
    Other proteins in same PDB: d2qadb1, d2qadd1, d2qadd2, d2qadf1, d2qadh1, d2qadh2
    automatically matched to d1g9mc2
    complexed with edo, mla, nag

Details for d2qadb2

PDB Entry: 2qad (more details), 3.3 Å

PDB Description: structure of tyrosine-sulfated 412d antibody complexed with hiv-1 yu2 gp120 and cd4
PDB Compounds: (B:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d2qadb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qadb2 b.1.1.3 (B:98-178) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla

SCOPe Domain Coordinates for d2qadb2:

Click to download the PDB-style file with coordinates for d2qadb2.
(The format of our PDB-style files is described here.)

Timeline for d2qadb2: