Lineage for d2qadb1 (2qad B:1-97)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1755540Protein CD4 V-set domains [48737] (2 species)
  7. 1755541Species Human (Homo sapiens) [TaxId:9606] [48738] (31 PDB entries)
  8. 1755566Domain d2qadb1: 2qad B:1-97 [150203]
    Other proteins in same PDB: d2qadb2, d2qadd1, d2qadd2, d2qadf2, d2qadh1, d2qadh2
    automatically matched to d1cdia1
    complexed with edo, mla, nag

Details for d2qadb1

PDB Entry: 2qad (more details), 3.3 Å

PDB Description: structure of tyrosine-sulfated 412d antibody complexed with hiv-1 yu2 gp120 and cd4
PDB Compounds: (B:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d2qadb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qadb1 b.1.1.1 (B:1-97) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

SCOPe Domain Coordinates for d2qadb1:

Click to download the PDB-style file with coordinates for d2qadb1.
(The format of our PDB-style files is described here.)

Timeline for d2qadb1: