Lineage for d2qa4y1 (2qa4 Y:95-236)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1353286Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 1353341Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 1353342Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 1353343Protein Ribosomal protein L32e [52044] (1 species)
  7. 1353344Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
    Uniprot P12736
  8. 1353400Domain d2qa4y1: 2qa4 Y:95-236 [150198]
    Other proteins in same PDB: d2qa411, d2qa421, d2qa431, d2qa4b1, d2qa4c1, d2qa4d1, d2qa4f1, d2qa4g1, d2qa4h1, d2qa4i1, d2qa4j1, d2qa4k1, d2qa4l1, d2qa4m1, d2qa4n1, d2qa4o1, d2qa4p1, d2qa4q1, d2qa4r1, d2qa4s1, d2qa4t1, d2qa4u1, d2qa4v1, d2qa4w1, d2qa4x1, d2qa4z1
    automatically matched to d1jj2x_
    complexed with cd, cl, k, mg, na

Details for d2qa4y1

PDB Entry: 2qa4 (more details), 3 Å

PDB Description: A more complete structure of the the L7/L12 stalk of the Haloarcula marismortui 50S large ribosomal subunit
PDB Compounds: (Y:) 50S ribosomal protein L32e

SCOPe Domain Sequences for d2qa4y1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qa4y1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOPe Domain Coordinates for d2qa4y1:

Click to download the PDB-style file with coordinates for d2qa4y1.
(The format of our PDB-style files is described here.)

Timeline for d2qa4y1: