SCOPe 2.01: Domain d2qa4i1: 2qa4 I:67-130

Lineage for d2qa4i1 (2qa4 I:67-130)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)

7. Species Haloarcula marismortui [TaxId:2238] [109705] (39 PDB entries)
   Uniprot P14122 67-136

8. Domain d2qa4i1: 2qa4 I:67-130 [150182]
   Other proteins in same PDB: d2qa411, d2qa421, d2qa431, d2qa4b1, d2qa4c1, d2qa4d1, d2qa4f1, d2qa4g1, d2qa4h1, d2qa4j1, d2qa4k1, d2qa4l1, d2qa4m1, d2qa4n1, d2qa4o1, d2qa4p1, d2qa4q1, d2qa4r1, d2qa4s1, d2qa4t1, d2qa4u1, d2qa4v1, d2qa4w1, d2qa4x1, d2qa4y1, d2qa4z1
   automatically matched to d1s72i_
   complexed with cd, cl, k, mg, na

Details for d2qa4i1

PDB Entry: 2qa4, 3 Å

PDB Description: A more complete structure of the the L7/L12 stalk of the Haloarcula marismortui 50S large ribosomal subunit

PDB Compounds: (I:) 50S ribosomal protein L11P

SCOPe Domain Sequences for d2qa4i1:

Sequence; same for both SEQRES and ATOM records:

>d2qa4i1 a.4.7.1 (I:67-130) Ribosomal protein L11, C-terminal domain {Haloarcula marismortui [TaxId: 2238]}
gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg
tcts

Timeline for d2qa4i1:

• d2qa4i1 first appeared in SCOP 1.75
  
• d2qa4i1 appears in SCOPe 2.02
  
• d2qa4i1 appears in the current release, SCOPe 2.08