SCOPe 2.03: Domain d2qa4g1: 2qa4 G:12-73

Lineage for d2qa4g1 (2qa4 G:12-73)

1. Root: SCOPe 2.03

2. Class j: Peptides [58231] (120 folds)

3. Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)

4. Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family)

5. Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)

6. Protein Ribosomal protein L10 [64661] (1 species)
   two alpha-helical segments visible in the crystal structure

7. Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
   Uniprot P15825

8. Domain d2qa4g1: 2qa4 G:12-73 [150180]
   Other proteins in same PDB: d2qa411, d2qa421, d2qa431, d2qa4b1, d2qa4c1, d2qa4d1, d2qa4f1, d2qa4h1, d2qa4i1, d2qa4j1, d2qa4k1, d2qa4l1, d2qa4m1, d2qa4n1, d2qa4o1, d2qa4p1, d2qa4q1, d2qa4r1, d2qa4s1, d2qa4t1, d2qa4u1, d2qa4v1, d2qa4w1, d2qa4x1, d2qa4y1, d2qa4z1
   automatically matched to 1VQ4 G:12-73
   complexed with cd, cl, k, mg, na

Details for d2qa4g1

PDB Entry: 2qa4, 3 Å

PDB Description: A more complete structure of the the L7/L12 stalk of the Haloarcula marismortui 50S large ribosomal subunit

PDB Compounds: (G:) acidic ribosomal protein p0 homo

SCOPe Domain Sequences for d2qa4g1:

Sequence; same for both SEQRES and ATOM records:

>d2qa4g1 j.84.1.1 (G:12-73) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Timeline for d2qa4g1:

• d2qa4g1 first appeared in SCOP 1.75
  
• d2qa4g1 appears in SCOPe 2.02
  
• d2qa4g1 appears in SCOPe 2.04
  
• d2qa4g1 appears in the current release, SCOPe 2.08