Lineage for d2qa4f1 (2qa4 F:1-119)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865651Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 865875Superfamily d.79.3: L30e-like [55315] (3 families) (S)
  5. 865876Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 865893Protein Ribosomal protein L7ae [55319] (7 species)
  7. 865899Species Archaeon Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries)
    Uniprot P12743
  8. 865955Domain d2qa4f1: 2qa4 F:1-119 [150179]
    Other proteins in same PDB: d2qa411, d2qa421, d2qa431, d2qa4b1, d2qa4c1, d2qa4d1, d2qa4g1, d2qa4h1, d2qa4i1, d2qa4j1, d2qa4k1, d2qa4l1, d2qa4m1, d2qa4n1, d2qa4o1, d2qa4p1, d2qa4q1, d2qa4r1, d2qa4s1, d2qa4t1, d2qa4u1, d2qa4v1, d2qa4w1, d2qa4x1, d2qa4y1, d2qa4z1
    automatically matched to d1s72f_
    complexed with cd, cl, k, mg, na, omg, omu, psu, ur3

Details for d2qa4f1

PDB Entry: 2qa4 (more details), 3 Å

PDB Description: A more complete structure of the the L7/L12 stalk of the Haloarcula marismortui 50S large ribosomal subunit
PDB Compounds: (F:) 50S ribosomal protein L7Ae

SCOP Domain Sequences for d2qa4f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qa4f1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr

SCOP Domain Coordinates for d2qa4f1:

Click to download the PDB-style file with coordinates for d2qa4f1.
(The format of our PDB-style files is described here.)

Timeline for d2qa4f1: