Lineage for d1vrea_ (1vre A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 93449Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 93450Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 93460Family a.1.1.2: Globins [46463] (18 proteins)
  6. 93496Protein Glycera globin [46467] (1 species)
  7. 93497Species Marine bloodworm (Glycera dibranchiata) [TaxId:6350] [46468] (4 PDB entries)
  8. 93500Domain d1vrea_: 1vre A: [15017]

Details for d1vrea_

PDB Entry: 1vre (more details)

PDB Description: solution structure of component iv glycera dibranchiata monomeric hemoglobin-co

SCOP Domain Sequences for d1vrea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vrea_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata)}
glsaaqrqvvastwkdiagsdngagvgkecftkflsahhdmaavfgfsgasdpgvadlga
kvlaqigvavshlgdegkmvaemkavgvrhkgygnkhikaeyfeplgasllsamehrigg
kmnaaakdawaaayadisgalisglqs

SCOP Domain Coordinates for d1vrea_:

Click to download the PDB-style file with coordinates for d1vrea_.
(The format of our PDB-style files is described here.)

Timeline for d1vrea_: