Lineage for d1hbg__ (1hbg -)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 349260Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 349261Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 349289Family a.1.1.2: Globins [46463] (20 proteins)
    Heme-binding protein
  6. 349327Protein Glycera globin [46467] (1 species)
  7. 349328Species Marine bloodworm (Glycera dibranchiata) [TaxId:6350] [46468] (8 PDB entries)
  8. 349334Domain d1hbg__: 1hbg - [15015]
    complexed with hem

Details for d1hbg__

PDB Entry: 1hbg (more details), 1.5 Å

PDB Description: glycera dibranchiata hemoglobin. structure and refinement at 1.5 angstroms resolution

SCOP Domain Sequences for d1hbg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbg__ a.1.1.2 (-) Glycera globin {Marine bloodworm (Glycera dibranchiata)}
glsaaqrqviaatwkdiagadngagvgkkclikflsahpqmaavfgfsgasdpgvaalga
kvlaqigvavshlgdegkmvaqmkavgvrhkgygnkhikaqyfeplgasllsamehrigg
kmnaaakdawaaayadisgalisglqs

SCOP Domain Coordinates for d1hbg__:

Click to download the PDB-style file with coordinates for d1hbg__.
(The format of our PDB-style files is described here.)

Timeline for d1hbg__: