Lineage for d2q86d2 (2q86 D:112-235)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 786831Protein T-cell antigen receptor [49125] (6 species)
  7. 786933Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries)
  8. 786935Domain d2q86d2: 2q86 D:112-235 [150123]
    Other proteins in same PDB: d2q86b1, d2q86d1
    automatically matched to d1g6rb2
    complexed with bma, fuc, man, nag; mutant

Details for d2q86d2

PDB Entry: 2q86 (more details), 1.85 Å

PDB Description: structure of the mouse invariant nkt cell receptor valpha14
PDB Compounds: (D:) Vbeta8.2

SCOP Domain Sequences for d2q86d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q86d2 b.1.1.2 (D:112-235) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrnvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvctdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgra

SCOP Domain Coordinates for d2q86d2:

Click to download the PDB-style file with coordinates for d2q86d2.
(The format of our PDB-style files is described here.)

Timeline for d2q86d2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q86d1