Lineage for d2q86b1 (2q86 B:3-111)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 783727Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 783866Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (27 PDB entries)
  8. 783868Domain d2q86b1: 2q86 B:3-111 [150120]
    Other proteins in same PDB: d2q86b2, d2q86d2
    automatically matched to d1g6rb1
    complexed with bma, fuc, man, nag; mutant

Details for d2q86b1

PDB Entry: 2q86 (more details), 1.85 Å

PDB Description: structure of the mouse invariant nkt cell receptor valpha14
PDB Compounds: (B:) Vbeta8.2

SCOP Domain Sequences for d2q86b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q86b1 b.1.1.1 (B:3-111) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvle

SCOP Domain Coordinates for d2q86b1:

Click to download the PDB-style file with coordinates for d2q86b1.
(The format of our PDB-style files is described here.)

Timeline for d2q86b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q86b2