Lineage for d2q85a2 (2q85 A:201-342)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224043Fold d.146: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain [56193] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2224044Superfamily d.146.1: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain [56194] (2 families) (S)
  5. 2224045Family d.146.1.1: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain [56195] (1 protein)
  6. 2224046Protein Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain [56196] (2 species)
    N-terminal domain is a FAD-binding domain
  7. 2224047Species Escherichia coli [TaxId:562] [56197] (5 PDB entries)
  8. 2224051Domain d2q85a2: 2q85 A:201-342 [150119]
    Other proteins in same PDB: d2q85a1
    automated match to d1mbba2
    complexed with 973, fad

Details for d2q85a2

PDB Entry: 2q85 (more details), 2.51 Å

PDB Description: Crystal Structure of E. Coli Mur B bound to a Naphthyl Tetronic Acid inihibitor
PDB Compounds: (A:) udp-n-acetylenolpyruvoylglucosamine reductase

SCOPe Domain Sequences for d2q85a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q85a2 d.146.1.1 (A:201-342) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain {Escherichia coli [TaxId: 562]}
vtpqqvfnavchmrttklpdpkvngnagsffknpvvsaetakallsqfptapnypqadgs
vklaagwlidqcqlkgmqiggaavhrqqalvlinednaksedvvqlahhvrqkvgekfnv
wlepevrfigasgevsavetis

SCOPe Domain Coordinates for d2q85a2:

Click to download the PDB-style file with coordinates for d2q85a2.
(The format of our PDB-style files is described here.)

Timeline for d2q85a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q85a1