Lineage for d1flp__ (1flp -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 44013Protein Hemoglobin I [46464] (2 species)
  7. 44041Species Clam (Lucina pectinata) [TaxId:244486] [46466] (4 PDB entries)
  8. 44043Domain d1flp__: 1flp - [15011]

Details for d1flp__

PDB Entry: 1flp (more details), 1.5 Å

PDB Description: structure of the sulfide-reactive hemoglobin from the clam lucina pectinata: crystallographic analysis at 1.5 angstroms resolution

SCOP Domain Sequences for d1flp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1flp__ a.1.1.2 (-) Hemoglobin I {Clam (Lucina pectinata)}
sleaaqksnvtsswakasaawgtagpeffmalfdahddvfakfsglfsgaakgtvkntpe
maaqaqsfkglvsnwvdnldnagalegqcktfaanhkargisagqleaafkvlsgfmksy
ggdegawtavagalmgeiepdm

SCOP Domain Coordinates for d1flp__:

Click to download the PDB-style file with coordinates for d1flp__.
(The format of our PDB-style files is described here.)

Timeline for d1flp__: