Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein CD1, alpha-3 domain [88615] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88616] (7 PDB entries) |
Domain d2q7yc1: 2q7y C:186-279 [150109] Other proteins in same PDB: d2q7ya2, d2q7yb_, d2q7yc2, d2q7yd_ automatically matched to d1cd1a1 complexed with igc, nag, plm |
PDB Entry: 2q7y (more details), 1.95 Å
SCOPe Domain Sequences for d2q7yc1:
Sequence, based on SEQRES records: (download)
>d2q7yc1 b.1.1.2 (C:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw ylqatldveageeaglacrvkhsslggqdiilyw
>d2q7yc1 b.1.1.2 (C:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqa tldveageeaglacrvkhsslggqdiilyw
Timeline for d2q7yc1:
View in 3D Domains from other chains: (mouse over for more information) d2q7ya1, d2q7ya2, d2q7yb_, d2q7yd_ |