SCOPe 2.03: Domain d2q7ya2: 2q7y A:7-185

Lineage for d2q7ya2 (2q7y A:7-185)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
   Class I MHC-related

7. Species Mouse (Mus musculus) [TaxId:10090] [54457] (18 PDB entries)

8. Domain d2q7ya2: 2q7y A:7-185 [150107]
   Other proteins in same PDB: d2q7ya1, d2q7yb_, d2q7yc1, d2q7yd_
   automated match to d1onqa2
   complexed with igc, nag, plm

Details for d2q7ya2

PDB Entry: 2q7y, 1.95 Å

PDB Description: structure of the endogenous inkt cell ligand igb3 bound to mcd1d

PDB Compounds: (A:) T-cell surface glycoprotein CD1d1

SCOPe Domain Sequences for d2q7ya2:

Sequence; same for both SEQRES and ATOM records:

>d2q7ya2 d.19.1.1 (A:7-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d2q7ya2:

• d2q7ya2 first appeared in SCOP 1.75
  
• d2q7ya2 appears in SCOPe 2.02
  
• d2q7ya2 appears in SCOPe 2.04
  
• d2q7ya2 appears in the current release, SCOPe 2.08