Lineage for d2q59a_ (2q59 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923666Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 923667Species Human (Homo sapiens) [TaxId:9606] [48525] (59 PDB entries)
    Uniprot P37231 232-505
  8. 923680Domain d2q59a_: 2q59 A: [150043]
    automated match to d1wm0x_
    complexed with 240

Details for d2q59a_

PDB Entry: 2q59 (more details), 2.2 Å

PDB Description: crystal structure of ppargamma lbd bound to full agonist mrl20
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d2q59a_:

Sequence, based on SEQRES records: (download)

>d2q59a_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykd

Sequence, based on observed residues (ATOM records): (download)

>d2q59a_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkevair
ifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvl
isegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgl
lnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikkte
tdmslhpllqeiykd

SCOPe Domain Coordinates for d2q59a_:

Click to download the PDB-style file with coordinates for d2q59a_.
(The format of our PDB-style files is described here.)

Timeline for d2q59a_: