SCOPe 2.06: Domain d2q2ub2: 2q2u B:2-189

Lineage for d2q2ub2 (2q2u B:2-189)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families)
   has a circularly permuted topology

5. Family d.142.2.1: ATP-dependent DNA ligase catalytic domain [56092] (2 proteins)
   automatically mapped to Pfam PF01068

6. Protein ATP-dependent DNA ligase, N-terminal domain [56093] (2 species)

7. Species Chlorella virus PBCV-1 [TaxId:10506] [56095] (4 PDB entries)

8. Domain d2q2ub2: 2q2u B:2-189 [150019]
   Other proteins in same PDB: d2q2ua1, d2q2ub1, d2q2uc1, d2q2ud1
   automatically matched to d1p8la2
   protein/DNA complex

Details for d2q2ub2

PDB Entry: 2q2u, 3 Å

PDB Description: structure of chlorella virus dna ligase-product dna complex

PDB Compounds: (B:) Chlorella virus DNA ligase

SCOPe Domain Sequences for d2q2ub2:

Sequence; same for both SEQRES and ATOM records:

>d2q2ub2 d.142.2.1 (B:2-189) ATP-dependent DNA ligase, N-terminal domain {Chlorella virus PBCV-1 [TaxId: 10506]}
aitkpllaatleniedvqfpclatpkidgirsvkqtqmlsrtfkpirnsvmnrlltellp
egsdgeisiegatfqdttsavmtghkmynakfsyywfdyvtddplkkyidrvedmknyit
vhphilehaqvkiiplipveinnitellqyerdvlskgfegvmirkpdgkykfgrstlke
gillkmkq

Timeline for d2q2ub2:

• d2q2ub2 first appeared in SCOP 1.75
  
• d2q2ub2 appears in SCOPe 2.05
  
• d2q2ub2 appears in SCOPe 2.07
  
• d2q2ub2 appears in the current release, SCOPe 2.08