SCOPe 2.02: Domain d2q2ua1: 2q2u A:190-293

Lineage for d2q2ua1 (2q2u A:190-293)

Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds)
Fold b.40: OB-fold [50198] (16 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)
Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins)
Protein ATP-dependent DNA ligase [50310] (2 species)
Species Chlorella virus PBCV-1 [TaxId:10506] [50312] (4 PDB entries)
Domain d2q2ua1: 2q2u A:190-293 [150016]
Other proteins in same PDB: d2q2ua2, d2q2ub2, d2q2uc2, d2q2ud2
automatically matched to d1p8la1
protein/DNA complex

Details for d2q2ua1

PDB Description: structure of chlorella virus dna ligase-product dna complex

PDB Compounds: (A:) Chlorella virus DNA ligase

SCOPe Domain Sequences for d2q2ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q2ua1 b.40.4.6 (A:190-293) ATP-dependent DNA ligase {Chlorella virus PBCV-1 [TaxId: 10506]}
fkdaeatiismtalfkntntktkdnfgyskrsthksgkveedvmgsievdydgvvfsigt
gfdadqrrdfwqnkesyigkmvkfkyfemgskdcprfpvfigir

SCOPe Domain Coordinates for d2q2ua1:

Click to download the PDB-style file with coordinates for d2q2ua1.
(The format of our PDB-style files is described here.)

Timeline for d2q2ua1: