SCOP 1.75: Domain d2q0tc1: 2q0t C:6-254

Lineage for d2q0tc1 (2q0t C:6-254)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.152: AhpD-like [69117] (1 superfamily)
   multihelical; contains 4-helical bundle and 2-helical arm

4. Superfamily a.152.1: AhpD-like [69118] (4 families)
   probable biological unit contains six domains of this fold arranged with 32 symmetry

5. Family a.152.1.1: AhpD [69119] (2 proteins)
   duplication: two-domain subunits form a helix-swapped trimer

6. Protein Hypothetical protein Bxeno_B2006 [158819] (1 species)

7. Species Burkholderia xenovorans [TaxId:36873] [158820] (1 PDB entry)
   Uniprot Q13LR5 1-257

8. Domain d2q0tc1: 2q0t C:6-254 [149992]
   automatically matched to 2Q0T A:1-257

Details for d2q0tc1

PDB Entry: 2q0t, 1.7 Å

PDB Description: crystal structure of a putative gamma-carboxymuconolactone decarboxylase subunit (bxe_b0980) from burkholderia xenovorans lb400 at 1.70 a resolution

PDB Compounds: (C:) Putative gamma-carboxymuconolactone decarboxylase subunit

SCOP Domain Sequences for d2q0tc1:

Sequence; same for both SEQRES and ATOM records:

>d2q0tc1 a.152.1.1 (C:6-254) Hypothetical protein Bxeno_B2006 {Burkholderia xenovorans [TaxId: 36873]}
pqpdpsrlrdelvrlhgkaspewdslvrldprfvdaylkfagvpqrrnhlddktrafial
aadacatqlyapgvarhieralsfgatreelievlelvstigihtsnvgvpvllevleee
glrkgapplderrqklkaefetnrgywhptweglleldpdlfeayvefssvpwrtgvlsp
kikefmycafdasathlyvpglklhirnalrygataeelmelleivsvtgihgaelgapl
leaalkrsg

Timeline for d2q0tc1:

• d2q0tc1 is new in SCOP 1.75
  
• d2q0tc1 is called d2q0tc_ in SCOPe 2.01
  
• d2q0tc1 appears in the current release, SCOPe 2.08, called d2q0tc_