SCOP 1.75: Domain d2pyea2: 2pye A:1-181

Lineage for d2pyea2 (2pye A:1-181)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (76 PDB entries)
   Uniprot P01892 25-298

8. Domain d2pyea2: 2pye A:1-181 [149940]
   Other proteins in same PDB: d2pyea1, d2pyeb1
   automatically matched to d1akja2
   complexed with 7pe, gol, pge, so4

Details for d2pyea2

PDB Entry: 2pye, 2.3 Å

PDB Description: Crystal Structures of High Affinity Human T-Cell Receptors Bound to pMHC RevealNative Diagonal Binding Geometry TCR Clone C5C1 Complexed with MHC

PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOP Domain Sequences for d2pyea2:

Sequence; same for both SEQRES and ATOM records:

>d2pyea2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d2pyea2:

• d2pyea2 is new in SCOP 1.75
  
• d2pyea2 appears in SCOPe 2.01
  
• d2pyea2 appears in the current release, SCOPe 2.08