Lineage for d2py7x2 (2py7 X:6-227)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 848369Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 848370Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (1 family) (S)
  5. 848371Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins)
  6. 848382Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (3 species)
  7. 848383Species Escherichia coli [TaxId:562] [68926] (10 PDB entries)
  8. 848388Domain d2py7x2: 2py7 X:6-227 [149934]
    Other proteins in same PDB: d2py7x1
    automatically matched to d1ayla2
    complexed with atp, mg, mn; mutant

Details for d2py7x2

PDB Entry: 2py7 (more details), 2.2 Å

PDB Description: Crystal structure of E. coli phosphoenolpyruvate carboxykinase mutant Lys213Ser complexed with ATP-Mg2+-Mn2+
PDB Compounds: (X:) phosphoenolpyruvate carboxykinase

SCOP Domain Sequences for d2py7x2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2py7x2 c.109.1.1 (X:6-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]}
gltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgr
spkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafc
ganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqgl
nsenfvafnltermqliggtwyggemksgmfsmmnyllplkg

SCOP Domain Coordinates for d2py7x2:

Click to download the PDB-style file with coordinates for d2py7x2.
(The format of our PDB-style files is described here.)

Timeline for d2py7x2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2py7x1