Lineage for d5hbib_ (5hbi B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 758486Protein Hemoglobin I [46464] (2 species)
  7. 758487Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (17 PDB entries)
  8. 758501Domain d5hbib_: 5hbi B: [14993]
    complexed with cmo, hem; mutant

Details for d5hbib_

PDB Entry: 5hbi (more details), 1.6 Å

PDB Description: scapharca dimeric hemoglobin, mutant t72i, co-liganded form
PDB Compounds: (B:) hemoglobin

SCOP Domain Sequences for d5hbib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hbib_ a.1.1.2 (B:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsiilmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

SCOP Domain Coordinates for d5hbib_:

Click to download the PDB-style file with coordinates for d5hbib_.
(The format of our PDB-style files is described here.)

Timeline for d5hbib_: