SCOP 1.75: Domain d2pxyd2: 2pxy D:4-93

Lineage for d2pxyd2 (2pxy D:4-93)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Mouse (Mus musculus), I-A(G7) [TaxId:10090] [88830] (5 PDB entries)

8. Domain d2pxyd2: 2pxy D:4-93 [149925]
   Other proteins in same PDB: d2pxyc1, d2pxyc2, d2pxyd1
   automatically matched to d1f3jb2
   mutant

Details for d2pxyd2

PDB Entry: 2pxy, 2.23 Å

PDB Description: Crystal structures of immune receptor complexes

PDB Compounds: (D:) H-2 class II histocompatibility antigen, A-U beta chain

SCOP Domain Sequences for d2pxyd2:

Sequence; same for both SEQRES and ATOM records:

>d2pxyd2 d.19.1.1 (D:4-93) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-A(G7) [TaxId: 10090]}
erhfvvqfqpfcyftngtqriryvtryiynreeylrfdsdvgeyravtelgrpdaeyynk
qylertraeldtvcrynyeetevptslrr

Timeline for d2pxyd2:

• d2pxyd2 is new in SCOP 1.75
  
• d2pxyd2 appears in SCOPe 2.01
  
• d2pxyd2 appears in the current release, SCOPe 2.08