Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (17 PDB entries) |
Domain d2pxyc2: 2pxy C:1-81 [149923] Other proteins in same PDB: d2pxyc1, d2pxyd1, d2pxyd2 automatically matched to d1k2da2 mutant |
PDB Entry: 2pxy (more details), 2.23 Å
SCOP Domain Sequences for d2pxyc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pxyc2 d.19.1.1 (C:1-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]} ieadhvgsygivvyqspgdigqytfefdgdelfyvdldkketiwmlpefaqlrsfdpqgg lqniatgkhnlgvltkrsnstp
Timeline for d2pxyc2: