Lineage for d2pxyc2 (2pxy C:1-81)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856736Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 856809Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (17 PDB entries)
  8. 856813Domain d2pxyc2: 2pxy C:1-81 [149923]
    Other proteins in same PDB: d2pxyc1, d2pxyd1, d2pxyd2
    automatically matched to d1k2da2
    mutant

Details for d2pxyc2

PDB Entry: 2pxy (more details), 2.23 Å

PDB Description: Crystal structures of immune receptor complexes
PDB Compounds: (C:) H-2 class II histocompatibility antigen, A-U alpha chain

SCOP Domain Sequences for d2pxyc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pxyc2 d.19.1.1 (C:1-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]}
ieadhvgsygivvyqspgdigqytfefdgdelfyvdldkketiwmlpefaqlrsfdpqgg
lqniatgkhnlgvltkrsnstp

SCOP Domain Coordinates for d2pxyc2:

Click to download the PDB-style file with coordinates for d2pxyc2.
(The format of our PDB-style files is described here.)

Timeline for d2pxyc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pxyc1