Lineage for d2pxyc1 (2pxy C:82-180)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2026687Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 2026753Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (27 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 2026760Domain d2pxyc1: 2pxy C:82-180 [149922]
    Other proteins in same PDB: d2pxya_, d2pxyb_, d2pxyc2, d2pxyc3, d2pxyd1, d2pxyd2
    automatically matched to d1k2da1

Details for d2pxyc1

PDB Entry: 2pxy (more details), 2.23 Å

PDB Description: Crystal structures of immune receptor complexes
PDB Compounds: (C:) H-2 class II histocompatibility antigen, A-U alpha chain

SCOPe Domain Sequences for d2pxyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pxyc1 b.1.1.2 (C:82-180) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhwep

SCOPe Domain Coordinates for d2pxyc1:

Click to download the PDB-style file with coordinates for d2pxyc1.
(The format of our PDB-style files is described here.)

Timeline for d2pxyc1: