SCOPe 2.02: Domain d2pxka_: 2pxk A:

Lineage for d2pxka_ (2pxk A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
   4 helices; orthogonal array

4. Superfamily a.36.1: Signal peptide-binding domain [47446] (1 family)

5. Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins)

6. Protein Signal sequence binding protein Ffh [47448] (3 species)

7. Species Escherichia coli [TaxId:562] [47449] (14 PDB entries)

8. Domain d2pxka_: 2pxk A: [149914]
   automated match to d1hq1a_
   protein/RNA complex; complexed with nco

Details for d2pxka_

PDB Entry: 2pxk, 2 Å

PDB Description: variant 8 of ribonucleoprotein core of the e. coli signal recognition particle

PDB Compounds: (A:) signal recognition particle protein

SCOPe Domain Sequences for d2pxka_:

Sequence, based on SEQRES records:

>d2pxka_ a.36.1.1 (A:) Signal sequence binding protein Ffh {Escherichia coli [TaxId: 562]}
fdlndfleqlrqmknmggmaslmgklpgmgqipdnvksqmddkvlvrmeaiinsmtmker
akpeiikgsrkrriaagsgmqvqdvnrllkqfddmqrmmkkm

Sequence, based on observed residues (ATOM records):

>d2pxka_ a.36.1.1 (A:) Signal sequence binding protein Ffh {Escherichia coli [TaxId: 562]}
fdlndfleqkvlvrmeaiinsmtmkerakpeiikgsrkrriaagsgmqvqdvnrllkqfd
dmqrmmkkm

Timeline for d2pxka_:

• d2pxka_ first appeared in SCOP 1.75, called d2pxka1
  
• d2pxka_ appears in SCOPe 2.01
  
• d2pxka_ appears in SCOPe 2.03
  
• d2pxka_ appears in the current release, SCOPe 2.08