Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (4 families) |
Family d.20.1.1: UBC-related [54496] (6 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (32 species) |
Species Human (Homo sapiens), ubc9 [TaxId:9606] [54503] (11 PDB entries) identical sequence in many other species |
Domain d2px9b1: 2px9 B:1-158 [149906] automatically matched to d1u9aa_ |
PDB Entry: 2px9 (more details)
SCOP Domain Sequences for d2px9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2px9b1 d.20.1.1 (B:1-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} msgialsrlaqerkawrkdhpfgfvavptknpdgtmnlmnwecaipgkkgtpwegglfkl rmlfkddypssppkckfepplfhpnvypsgtvclsileedkdwrpaitikqillgiqell nepniqdpaqaeaytiycqnrveyekrvraqakkfaps
Timeline for d2px9b1: