SCOP 1.75: Domain d2pvra1: 2pvr A:2-329

Lineage for d2pvra1 (2pvr A:2-329)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Protein kinase CK2, alpha subunit [56142] (3 species)
   CMGC group; CK2 subfamily; serine/threonine kinase

7. Species Rattus norvegicus [TaxId:10116] [160809] (5 PDB entries)

8. Domain d2pvra1: 2pvr A:2-329 [149893]
   automatically matched to d1jwha_
   complexed with anp, so4; mutant

Details for d2pvra1

PDB Entry: 2pvr, 1.6 Å

PDB Description: crystal structure of the catalytic subunit of protein kinase ck2 (c- terminal deletion mutant 1-335) in complex with two sulfate ions

PDB Compounds: (A:) Casein kinase II subunit alpha, catalytic subunit

SCOP Domain Sequences for d2pvra1:

Sequence; same for both SEQRES and ATOM records:

>d2pvra1 d.144.1.7 (A:2-329) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]}
sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
dkllrydhqsrltareamehpyfytvvk

Timeline for d2pvra1:

• d2pvra1 is new in SCOP 1.75
  
• d2pvra1 is called d2pvra_ in SCOPe 2.01
  
• d2pvra1 appears in the current release, SCOPe 2.08, called d2pvra_