| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.223: Triger factor/SurA peptide-binding domain-like [109997] (1 superfamily) multihelical; irregular array of long and short helices |
Superfamily a.223.1: Triger factor/SurA peptide-binding domain-like [109998] (2 families) ![]() there are sequence and functional similarities between the families, but their structural similarity is obscured by conformational flexibility (in the TF family) |
| Family a.223.1.2: Porin chaperone SurA, peptide-binding domain [81828] (1 protein) |
| Protein Porin chaperone SurA, peptide-binding domain [81829] (1 species) |
| Species Escherichia coli [TaxId:562] [81830] (2 PDB entries) |
| Domain d2pv3b1: 2pv3 B:25-163,B:396-427 [149884] Other proteins in same PDB: d2pv3a2, d2pv3b2 automatically matched to d1m5yd1 |
PDB Entry: 2pv3 (more details), 3.39 Å
SCOP Domain Sequences for d2pv3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pv3b1 a.223.1.2 (B:25-163,B:396-427) Porin chaperone SurA, peptide-binding domain {Escherichia coli [TaxId: 562]}
vdkvaavvnngvvlesdvdglmqsvklnaaqarqqlpddatlrhqimerlimdqiilqmg
qkmgvkisdeqldqaianiakqnnmtldqmrsrlaydglnyntyrnqirkemiisevrnn
evrrritilpqeveslaqqXrayrmlmnrkfseeaaswmqeqrasayvkils
Timeline for d2pv3b1: