Lineage for d2pv3a1 (2pv3 A:25-163,A:396-427)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2350771Fold a.223: Triger factor/SurA peptide-binding domain-like [109997] (1 superfamily)
    multihelical; irregular array of long and short helices
  4. 2350772Superfamily a.223.1: Triger factor/SurA peptide-binding domain-like [109998] (3 families) (S)
    there are sequence and functional similarities between the families, but their structural similarity is obscured by conformational flexibility (in the TF family)
  5. 2350782Family a.223.1.2: Porin chaperone SurA, peptide-binding domain [81828] (1 protein)
  6. 2350783Protein Porin chaperone SurA, peptide-binding domain [81829] (1 species)
  7. 2350784Species Escherichia coli [TaxId:562] [81830] (2 PDB entries)
  8. 2350789Domain d2pv3a1: 2pv3 A:25-163,A:396-427 [149882]
    Other proteins in same PDB: d2pv3a2, d2pv3b2
    automatically matched to d1m5yd1

Details for d2pv3a1

PDB Entry: 2pv3 (more details), 3.39 Å

PDB Description: crystallographic structure of sura fragment lacking the second peptidyl-prolyl isomerase domain complexed with peptide nftlkfwdifrk
PDB Compounds: (A:) Chaperone surA

SCOPe Domain Sequences for d2pv3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pv3a1 a.223.1.2 (A:25-163,A:396-427) Porin chaperone SurA, peptide-binding domain {Escherichia coli [TaxId: 562]}
vdkvaavvnngvvlesdvdglmqsvklnaaqarqqlpddatlrhqimerlimdqiilqmg
qkmgvkisdeqldqaianiakqnnmtldqmrsrlaydglnyntyrnqirkemiisevrnn
evrrritilpqeveslaqqXrayrmlmnrkfseeaaswmqeqrasayvkils

SCOPe Domain Coordinates for d2pv3a1:

Click to download the PDB-style file with coordinates for d2pv3a1.
(The format of our PDB-style files is described here.)

Timeline for d2pv3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pv3a2