![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.1: Enolase [51605] (2 proteins) automatically mapped to Pfam PF00113 |
![]() | Protein Enolase [51606] (11 species) Fold of this protein slightly differs from common fold in topology |
![]() | Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [159415] (6 PDB entries) |
![]() | Domain d2pu1a1: 2pu1 A:139-429 [149848] Other proteins in same PDB: d2pu1a2, d2pu1a3 automated match to d1oepa1 complexed with edo, fsg, zn |
PDB Entry: 2pu1 (more details), 1.8 Å
SCOPe Domain Sequences for d2pu1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pu1a1 c.1.11.1 (A:139-429) Enolase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} kelrlpvpcfnvinggkhagnalpfqefmiapvkatsfsealrmgsevyhslrgiikkky gqdavnvgdeggfappikdineplpilmeaieeaghrgkfaicmdcaasetydekkqqyn ltfkspeptwvtaeqlretyckwahdypivsiedpydqddfagfagitealkgktqivgd dltvtnterikmaiekkacnslllkinqigtiseaiassklcmengwsvmvshrsgeted tyiadlvvalgsgqiktgapcrgertaklnqllrieeelgahakfgfpgws
Timeline for d2pu1a1: